PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn129041
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family G2-like
Protein Properties Length: 442aa    MW: 48025.6 Da    PI: 6.7605
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn129041genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.55.6e-32241296156
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                 k+r++W+p+LH+rFv+a++ LGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Achn129041 241 KARRCWSPDLHRRFVNALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 296
                 68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.204238298IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-28239299IPR009057Homeodomain-like
SuperFamilySSF466896.81E-17239299IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-26241296IPR006447Myb domain, plants
PfamPF002497.6E-7243294IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 442 aa     Download sequence    Send to blast
MMASPPELSL DCKPHSYSML LKSFGDQTDQ TQKLEDFLAR LEEERLKIDA FKRELPLCMQ  60
LLTNAMEASR QQLQTYRMDQ GPVLEEFIPM KNSSSELGLE KDSNVSDMAS WMTSAQLWSP  120
ASDAAKQQQM TILTSPKERE IGFGVSPKLG LDNKQRNGGA FLPFSKEKNS GLSPTLALAN  180
SGGEVGEEKK VLEGENGNGG LRRESCVKAG LGEQGQGGNI PADSQANGNG AAAARNQSHR  240
KARRCWSPDL HRRFVNALQM LGGSQVATPK QIRELMKVDG LTNDEVKSHL QKYRLHTRRP  300
SPCPQATGAP TPQLVVLGGI WVPQEYASAA HGGAPQTLYS THPTTHVPPH YCAPQVPQEF  360
YTAPAASAHH QLHHHQLHMY HHGSPESDVR GGGDKSESME DGKSESSSGG ENGGGEGERK  420
GLGTLRDERE ESKGSEITLT F*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002529346.10.0PREDICTED: transcription factor LUX
RefseqXP_010254263.10.0PREDICTED: probable transcription factor GLK2
TrEMBLB9STM70.0B9STM7_RICCO; Putative uncharacterized protein
STRINGVIT_11s0016g04600.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA87942229
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-117G2-like family protein